Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Peptidyl-tRNA hydrolase 2, mitochondrial (PTH2), partial

This Recombinant Human Peptidyl-tRNA hydrolase 2, mitochondrial (PTH2), partial spans the amino acid sequence from region 38-179. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Peptidyl-tRNA hydrolase 2, mitochondrial; PTH 2; EC 3.1.1.29; Bcl-2 inhibitor of transcription 1; PTRH2 BIT1 PTH2 CGI-147

UniProt

Q9Y3E5

Expression Region

38-179

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GMLPKSKTSKTHTDTESEASILGDSGEYKMILVVRNDLKMGKGKVAAQCSHAAVSAYKQIQRRNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRTQIAPGSQTVLGIGPGPADLIDKVTGHLKLY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NKX1-2 Rabbit Polyclonal Antibody (BF488)
orb2442002 100 µL

NKX1-2 Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
SFRS12IP1 (SREK1IP1) (NM_173829) Human Recombinant Protein
TP319746L 1 mg

SFRS12IP1 (SREK1IP1) (NM_173829) Human Recombinant Protein

Sign In for Pricing
View Details
TNK1 (phospho-Tyr277) rabbit pAb
E44H14613 100 µL

TNK1 (phospho-Tyr277) rabbit pAb

Sign In for Pricing
View Details
Anti-A-RAF Antibody
A02061-3 100 µL

Anti-A-RAF Antibody

Sign In for Pricing
View Details
Bovine TCF21/Transcription factor 21 ELISA Kit
E0321Bo 96 Tests

Bovine TCF21/Transcription factor 21 ELISA Kit

Sign In for Pricing
View Details
Anti-Histone H1 (Phospho-Thr17) antibody
STJ97184 200 µl

Anti-Histone H1 (Phospho-Thr17) antibody

Sign In for Pricing
View Details