Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human F-box only protein 7 (FBX7)

This Recombinant Human F-box only protein 7 (FBX7) spans the amino acid sequence from region 1-522. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

F-box only protein 7 FBXO7 FBX7

UniProt

Q9Y3I1

Expression Region

1-522

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MRLRVRLLKRTWPLEVPETEPTLGHLRSHLRQSLLCTWGYSSNTRFTITLNYKDPLTGDEETLASYGIVSGDLICLILQDDIPAPNIPSSTDSEHSSLQNNEQPSLATSSNQTSMQDEQPSDSFQGQAAQSGVWNDDSMLGPSQNFEAESIQDNAHMAEGTGFYPSEPMLCSESVEGQVPHSLETLYQSADCSDANDALIVLIHLLMLESGYIPQGTEAKALSMPEKWKLSGVYKLQYMHPLCEGSSATLTCVPLGNLIVVNATLKINNEIRSVKRLQLLPESFICKEKLGENVANIYKDLQKLSRLFKDQLVYPLLAFTRQALNLPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDLFTASNDPLLWRFLYLRDFRDNTVRVQDTDWKELYRKRHIQRKESPKGRFVMLLPSSTHTIPFYPNPLHPRPFPSSRLPPGIIGGEYDQRPTLPYVGDPISSLIPGPGETPSQFPPLRPRFDPVGPLPGPNPILPGRGGPNDRFPFRPSRGRPTDGRLSFM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLF5 Mouse Monoclonal Antibody [Clone ID: OTI6D2]
CF811868 100 µg

KLF5 Mouse Monoclonal Antibody [Clone ID: OTI6D2]

Sign In for Pricing
View Details
SMAD5 Antibody
KC-2100-01 50 μL

SMAD5 Antibody

Sign In for Pricing
View Details
SMAD5 Antibody
KC-2100-02 100 µL

SMAD5 Antibody

Sign In for Pricing
View Details
SMAD5 Antibody
KC-2100-03 1 mL

SMAD5 Antibody

Sign In for Pricing
View Details
Nutm1 Recombinant Rabbit Monoclonal Antibody [PSH09-09]
HA721690 100 µL

Nutm1 Recombinant Rabbit Monoclonal Antibody [PSH09-09]

Sign In for Pricing
View Details
APC Anti-Human CD274/PD-L1 Antibody[29E.2A3]
E-AB-F1133E-01 20 Tests

APC Anti-Human CD274/PD-L1 Antibody[29E.2A3]

Sign In for Pricing
View Details