Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human U6 snRNA-associated Sm-like protein LSm5 (LSM5)

This Recombinant Human U6 snRNA-associated Sm-like protein LSm5 (LSM5) spans the amino acid sequence from region 2-91. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

U6 snRNA-associated Sm-like protein LSm5 LSM5

UniProt

Q9Y4Y9

Expression Region

2-91

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AANATTNPSQLLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNITMLVPGGEGPEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RASGRP2 Rabbit Polyclonal Antibody
TA361453 100 µL

RASGRP2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PRR6 (CENPV) (NM_181716) Human Over-expression Lysate
LY403626 100 µg

PRR6 (CENPV) (NM_181716) Human Over-expression Lysate

Sign In for Pricing
View Details
IL36G Antibody
KC-1581-01 50 μL

IL36G Antibody

Sign In for Pricing
View Details
IL36G Antibody
KC-1581-02 100 µL

IL36G Antibody

Sign In for Pricing
View Details
IL36G Antibody
KC-1581-03 1 mL

IL36G Antibody

Sign In for Pricing
View Details
Recombinant Cadherin-17/LI-cadherin/CDH17 Monoclonal Antibody
AN300232P 100 µL

Recombinant Cadherin-17/LI-cadherin/CDH17 Monoclonal Antibody

Sign In for Pricing
View Details