Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Claudin-16 (CLD16), partial

This Recombinant Human Claudin-16 (CLD16), partial spans the amino acid sequence from region 25-79. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Claudin-16; Paracellin-1; PCLN-1; CLDN16 PCLN1

UniProt

Q9Y5I7

Expression Region

25-79

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

WTDCWMVNADDSLEVSTKCRGLWWECVTNAFDGIRTCDEYDSILAEHPLKLVVTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Butachlor (>90%)
TRC-B689925-1G 1 g

Butachlor (>90%)

Sign In for Pricing
View Details
DNA Ligase 1 (1A9), CF647 conjugate, 0.1mg/mL
BNC472177-100 1x 100 µL

DNA Ligase 1 (1A9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SLU7 Mouse Monoclonal Antibody [Clone ID: OTI7B7]
CF810916 100 µg

SLU7 Mouse Monoclonal Antibody [Clone ID: OTI7B7]

Sign In for Pricing
View Details
(S)-(-)-2-Chloro-3-[4(5)-imidazolyl]propionic Acid
TRC-C366870-10MG 10 mg

(S)-(-)-2-Chloro-3-[4(5)-imidazolyl]propionic Acid

Sign In for Pricing
View Details
C9ORF46 (PLGRKT) Human Gene Knockout Kit (CRISPR)
KN202315RB 1 Kit

C9ORF46 (PLGRKT) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Drotaverine-d10 Hydrochloride
TRC-D689702-100MG 100 mg

Drotaverine-d10 Hydrochloride

Sign In for Pricing
View Details