Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Claudin-16 (CLD16), partial

This Recombinant Human Claudin-16 (CLD16), partial spans the amino acid sequence from region 25-79. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Claudin-16; Paracellin-1; PCLN-1; CLDN16 PCLN1

UniProt

Q9Y5I7

Expression Region

25-79

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

WTDCWMVNADDSLEVSTKCRGLWWECVTNAFDGIRTCDEYDSILAEHPLKLVVTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Transfectamine™ mRNA Transfection Reagent
60029-AAT 50 µL

Transfectamine™ mRNA Transfection Reagent

Sign In for Pricing
View Details
Alkaline Phosphatase Conjugated Sambucus nigra (Elderberry Bark) -SNA-I-
LA-6802-1 1 mg

Alkaline Phosphatase Conjugated Sambucus nigra (Elderberry Bark) -SNA-I-

Sign In for Pricing
View Details
1,9-Decadiene
TRC-D210515-2.5G 2.5 g

1,9-Decadiene

Sign In for Pricing
View Details
1-(2,4-Dichlorophenyl)-2-(imidazol-1-yl)ethanone hydrochloride
TRC-D802290-1G 1 g

1-(2,4-Dichlorophenyl)-2-(imidazol-1-yl)ethanone hydrochloride

Sign In for Pricing
View Details
G protein coupled receptor 30 (GPER1) (NM_001039966) Human Over-expression Lysate
LY421866 100 µg

G protein coupled receptor 30 (GPER1) (NM_001039966) Human Over-expression Lysate

Sign In for Pricing
View Details
N-1-Naphthylethylenediamine Dihydrochloride
TRC-N372480-250G 250 g

N-1-Naphthylethylenediamine Dihydrochloride

Sign In for Pricing
View Details