Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sorting nexin-5 (SNX5)

This Recombinant Human Sorting nexin-5 (SNX5) spans the amino acid sequence from region 2-404. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sorting nexin-5 SNX5

UniProt

Q9Y5X3

Expression Region

2-404

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AAVPELLQQQEEDRSKLRSVSVDLNVDPSLQIDIPDALSERDKVKFTVHTKTTLPTFQSPEFSVTRQHEDFVWLHDTLIETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEFAKMKQELEAEYLAVFKKTVSSHEVFLQRLSSHPVLSKDRNFHVFLEYDQDLSVRRKNTKEMFGGFFKSVVKSADEVLFTGVKEVDDFFEQEKNFLINYYNRIKDSCVKADKMTRSHKNVADDYIHTAACLHSLALEEPTVIKKYLLKVAELFEKLRKVEGRVSSDEDLKLTELLRYYMLNIEAAKDLLYRRTKALIDYENSNKALDKARLKSKDVKLAEAHQQECCQKFEQLSESAKEELINFKRKRVAAFRKNLIEMSELEIKHARNNVSLLQSCIDLFKNN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Putative uncharacterized protein LOC388820 (LOC388820) activation kit by CRISPRa
GA118004 1 Kit

Human Putative uncharacterized protein LOC388820 (LOC388820) activation kit by CRISPRa

Sign In for Pricing
View Details
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/1623), 0.2mg/mL
BNUB1623-100 1x 100 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/1623), 0.2mg/mL

Sign In for Pricing
View Details
MASPIN (SERPINB5) (NM_002639) Human Over-expression Lysate
LC419192 20 µg

MASPIN (SERPINB5) (NM_002639) Human Over-expression Lysate

Sign In for Pricing
View Details
Anti-Human Lambda Antibody
KC-1651-01 50 μL

Anti-Human Lambda Antibody

Sign In for Pricing
View Details
Anti-Human Lambda Antibody
KC-1651-02 100 µL

Anti-Human Lambda Antibody

Sign In for Pricing
View Details
Anti-Human Lambda Antibody
KC-1651-03 1 mL

Anti-Human Lambda Antibody

Sign In for Pricing
View Details