Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sodium channel protein type 10 subunit alpha (SCNAA), partial

This Recombinant Human Sodium channel protein type 10 subunit alpha (SCNAA), partial spans the amino acid sequence from region 273-341. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sodium channel protein type 10 subunit alpha; Peripheral nerve sodium channel 3; PN3; hPN3; Sodium channel protein type X subunit alpha; Voltage-gated sodium channel subunit alpha Nav1.8; SCN10A

UniProt

Q9Y5Y9

Expression Region

273-341

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KNKCVKNDMAVNETTNYSSHRKPDIYINKRGTSDPLLCGNGSDSGHCPDGYICLKTSDNPDFNYTSFDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PAI1 Recombinant Rabbit monoclonal Antibody
HA723435 100 µL

Human PAI1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
MAP3K19 (NM_001018046) Human Over-expression Lysate
LC422703 20 µg

MAP3K19 (NM_001018046) Human Over-expression Lysate

Sign In for Pricing
View Details
Slc33a1 Mouse Gene Knockout Kit (CRISPR)
KN516050 1 Kit

Slc33a1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FCN3 (C-term) Rabbit Polyclonal Antibody
AP51643PU-N 400 µL

FCN3 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD73 (NT5E) Human Gene Knockout Kit (CRISPR)
KN209568RB 1 Kit

CD73 (NT5E) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/1484), CF488A conjugate, 0.1mg/mL
BNC881484-100 1x 100 µL

DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/1484), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details