Recombinant Human Sodium channel protein type 10 subunit alpha (SCNAA), partial
This Recombinant Human Sodium channel protein type 10 subunit alpha (SCNAA), partial spans the amino acid sequence from region 273-341. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Sodium channel protein type 10 subunit alpha; Peripheral nerve sodium channel 3; PN3; hPN3; Sodium channel protein type X subunit alpha; Voltage-gated sodium channel subunit alpha Nav1.8; SCN10A
UniProt
Q9Y5Y9
Expression Region
273-341
Origin
Homo sapiens (Human)
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
KNKCVKNDMAVNETTNYSSHRKPDIYINKRGTSDPLLCGNGSDSGHCPDGYICLKTSDNPDFNYTSFDS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog