Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Myosin-4 (MYH4), partial

This Recombinant Human Myosin-4 (MYH4), partial spans the amino acid sequence from region 86-782. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Myosin-4; Myosin heavy chain 2b; MyHC-2b; Myosin heavy chain 4; Myosin heavy chain IIb; MyHC-IIb; Myosin heavy chain, skeletal muscle, fetal; MYH4

UniProt

Q9Y623

Expression Region

86-782

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DKIEDMAMMTHLHEPAVLYNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNPEVVTAYRGKKRQEAPPHIFSISDNAYQFMLTDRENQSILITGESGAGKTVNTKRVIQYFATIAVTGEKKKEEPASGKMQGTLEDQIISANPLLEAFGNAKTVRNDNSSRFGKFIRIHFGATGKLASADIETYLLEKSRVTFQLKAERSYHIFYQILSNKKPELIEMLLITTNPYDFAFVSQGEITVPSIDDQEELMATDSAVDILGFTADEKVAIYKLTGAVMHYGNMKFKQKQREEQAEPDGTEVADKAAYLTSLNSADLLKSLCYPRVKVGNEFVTKGQTVQQVYNAVGALAKAIYEKMFLWMVTRINQQLDTKQPRQYFIGVLDIAGFEIFDFNSLEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLAACIELIEKPMGIFSILEEECMFPKATDTSFKNKLYEQHLGKSNNFQKPKPAKGKPEAHFSLVHYAGTVDYNIAGWLDKNKDPLNETVVGLYQKSAMKTLAFLFSGAQTAEAEGGGGKKGGKKKGSSFQTVSALFRENLNKLMTNLRSTHPHFVRCIIPNETKTPGAMEHELVLHQLRCNGVLEGIRICRKGFPSRILYADFKQRYKVLNASAIPEGQFIDSKKASEKLLGSIEIDHTQYKFGHTKVFFKAGLLGTLEEMRD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SEMA4C Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV648012 1.0 µg DNA

SEMA4C Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Phospho-Ack1 (Tyr284) Rabbit Polyclonal Antibody (BF647)
orb2433160 100 µL

Phospho-Ack1 (Tyr284) Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
Heme Oxygenase 2 (HMOX2) Antibody (Biotin)
abx343520-01 50 µL

Heme Oxygenase 2 (HMOX2) Antibody (Biotin)

Sign In for Pricing
View Details
Heme Oxygenase 2 (HMOX2) Antibody (Biotin)
abx343520-02 100 µL

Heme Oxygenase 2 (HMOX2) Antibody (Biotin)

Sign In for Pricing
View Details
Heme Oxygenase 2 (HMOX2) Antibody (Biotin)
abx343520-03 200 µL

Heme Oxygenase 2 (HMOX2) Antibody (Biotin)

Sign In for Pricing
View Details
Heme Oxygenase 2 (HMOX2) Antibody (Biotin)
abx343520-04 1 mL

Heme Oxygenase 2 (HMOX2) Antibody (Biotin)

Sign In for Pricing
View Details