Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Solute carrier family 12 member 7 (S12A7), partial

This Recombinant Human Solute carrier family 12 member 7 (S12A7), partial spans the amino acid sequence from region 301-419. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Solute carrier family 12 member 7; Electroneutral potassium-chloride cotransporter 4; K-Cl cotransporter 4; SLC12A7 KCC4

UniProt

Q9Y666

Expression Region

301-419

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DPPDIPVCLLGNRTLSRRSFDACVKAYGIHNNSATSALWGLFCNGSQPSAACDEYFIQNNVTEIQGIPGAASGVFLENLWSTYAHAGAFVEKKGVPSVPVAEESRASALPYVLTDIAAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD28 (204.12), CF740 conjugate, 0.1mg/mL
BNC740164-100 1x 100 µL

CD28 (204.12), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF568 conjugate, 0.1mg/mL
BNC680160-100 1x 100 µL

CD20 (B9E9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF488A conjugate, 0.1mg/mL
BNC880178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF568 conjugate, 0.1mg/mL
BNC680146-100 1x 100 µL

CD10 (CB-CALLA), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF594 conjugate, 0.1mg/mL
BNC940177-100 1x 100 µL

CD50 (ICAM-3) (101-1D2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF594 conjugate, 0.1mg/mL
BNC940305-500 1x 500 µL

CD95 (B-R18), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details