Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Selenoprotein K (SELK), partial

This Recombinant Human Selenoprotein K (SELK), partial spans the amino acid sequence from region 43-94. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Selenoprotein K; SelK; SELENOK SELK HSPC030 HSPC297

UniProt

Q9Y6D0

Expression Region

43-94

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQDVKKRRSYGNSSDSRYDDGRGPPGNPPRRMGRINHLRGPSPPPMAGGUGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant SARS-CoV-2 Spike Protein (RBD, His Tag) (W436R)
PKSR030534 100 µg

Recombinant SARS-CoV-2 Spike Protein (RBD, His Tag) (W436R)

Sign In for Pricing
View Details
MAP1LC3A Antibody
F40815-0.4ML 0.4 mL

MAP1LC3A Antibody

Sign In for Pricing
View Details
Recombinant Human GFRA1/GDNFRA Protein (aa 1-424, His Tag)
PKSH031680-01 100 µg

Recombinant Human GFRA1/GDNFRA Protein (aa 1-424, His Tag)

Sign In for Pricing
View Details
Recombinant Human GFRA1/GDNFRA Protein (aa 1-424, His Tag)
PKSH031680-02 1 mg

Recombinant Human GFRA1/GDNFRA Protein (aa 1-424, His Tag)

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS807724 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
Zfp574 Mouse Gene Knockout Kit (CRISPR)
KN519885 1 Kit

Zfp574 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details