Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Selenoprotein K (SELK), partial

This Recombinant Human Selenoprotein K (SELK), partial spans the amino acid sequence from region 43-94. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Selenoprotein K; SelK; SELENOK SELK HSPC030 HSPC297

UniProt

Q9Y6D0

Expression Region

43-94

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQDVKKRRSYGNSSDSRYDDGRGPPGNPPRRMGRINHLRGPSPPPMAGGUGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgG Mouse Monoclonal Antibody [Clone ID: 4D2D9G8]
AM06072PU-N 100 µL

Human IgG Mouse Monoclonal Antibody [Clone ID: 4D2D9G8]

Sign In for Pricing
View Details
Thyroglobulin (2H11), CF640R conjugate, 0.1mg/mL
BNC400023-500 1x 500 µL

Thyroglobulin (2H11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Ctsh activation kit by CRISPRa
GA200951 1 Kit

Mouse Ctsh activation kit by CRISPRa

Sign In for Pricing
View Details
RUNX1 Mouse Monoclonal Antibody [Clone ID: 2B5]
AM06605SU-N 100 µL

RUNX1 Mouse Monoclonal Antibody [Clone ID: 2B5]

Sign In for Pricing
View Details
Human Melanoma Associated Chondroitin Sulfate Proteoglycan (MCSP) ELISA Kit
RDR-MCSP-Hu-01 96 Tests

Human Melanoma Associated Chondroitin Sulfate Proteoglycan (MCSP) ELISA Kit

Sign In for Pricing
View Details
Human Melanoma Associated Chondroitin Sulfate Proteoglycan (MCSP) ELISA Kit
RDR-MCSP-Hu-02 48 Tests

Human Melanoma Associated Chondroitin Sulfate Proteoglycan (MCSP) ELISA Kit

Sign In for Pricing
View Details