Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Choline/ethanolaminephosphotransferase 1 (CEPT1), partial

This Recombinant Human Choline/ethanolaminephosphotransferase 1 (CEPT1), partial spans the amino acid sequence from region 1-88. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Choline/ethanolaminephosphotransferase 1; hCEPT1; EC 2.7.8.1; EC 2.7.8.2; 1-alkenyl-2-acylglycerol choline phosphotransferase; EC 2.7.8.22; CEPT1 PRO1101

UniProt

Q9Y6K0

Expression Region

1-88

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research; Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSGHRSTRKRCGDSHPESPVGFGHMSTTGCVLNKLFQLPTPPLSRHQLKRLEEHRYQSAGRSLLEPLMQGYWEWLVRRVPSWIAPNLI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S100A10, ID (S100A10, ANX2LG, CAL1L, CLP11, Protein S100-A10, Calpactin I light chain, Calpactin-1 light chain, Cellular ligand of annexin II, S100 calcium-binding protein A10, p10 protein, p11) (FITC)
MBS6344626-01 0.2 mL

S100A10, ID (S100A10, ANX2LG, CAL1L, CLP11, Protein S100-A10, Calpactin I light chain, Calpactin-1 light chain, Cellular ligand of annexin II, S100 calcium-binding protein A10, p10 protein, p11) (FITC)

Sign In for Pricing
View Details
S100A10, ID (S100A10, ANX2LG, CAL1L, CLP11, Protein S100-A10, Calpactin I light chain, Calpactin-1 light chain, Cellular ligand of annexin II, S100 calcium-binding protein A10, p10 protein, p11) (FITC)
MBS6344626-02 5x 0.2 mL

S100A10, ID (S100A10, ANX2LG, CAL1L, CLP11, Protein S100-A10, Calpactin I light chain, Calpactin-1 light chain, Cellular ligand of annexin II, S100 calcium-binding protein A10, p10 protein, p11) (FITC)

Sign In for Pricing
View Details
Anti-PSMC3IP Antibody Picoband® Biotin Conjugated
A07882-1-Biotin 100 µg/Vial

Anti-PSMC3IP Antibody Picoband® Biotin Conjugated

Sign In for Pricing
View Details
GLB1 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
21572156 3x 1.0 µg DNA

GLB1 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Mouse Prolactin receptor (PRLR) ELISA Kit
orb1655272-01 48 Tests

Mouse Prolactin receptor (PRLR) ELISA Kit

Sign In for Pricing
View Details
Mouse Prolactin receptor (PRLR) ELISA Kit
orb1655272-02 96 Tests

Mouse Prolactin receptor (PRLR) ELISA Kit

Sign In for Pricing
View Details