Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tolloid-like protein 2 (TLL2), partial

This Recombinant Human Tolloid-like protein 2 (TLL2), partial spans the amino acid sequence from region 150-349. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tolloid-like protein 2; EC 3.4.24.-; TLL2 KIAA0932

UniProt

Q9Y6L7

Expression Region

150-349

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ATTSRTERIWPGGVIPYVIGGNFTGSQRAIFKQAMRHWEKHTCVTFIERTDEESFIVFSYRTCGCCSYVGRRGGGPQAISIGKNCDKFGIVAHELGHVVGFWHEHTRPDRDQHVTIIRENIQPGQEYNFLKMEAGEVSSLGETYDFDSIMHYARNTFSRGVFLDTILPRQDDNGVRPTIGQRVRLSQGDIAQARKLYKCP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMN Protein Vector (Human) (pPM-C-HA)
PV062063 500 ng

AMN Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Galnt2 Antibody - C-terminal region : FITC (ARP46460_P050-FITC)
ARP46460_P050-FITC 100 µL

Galnt2 Antibody - C-terminal region : FITC (ARP46460_P050-FITC)

Sign In for Pricing
View Details
PPP4C (Serine/Threonine Protein Phosphatase 4 Catalytic Subunit, Protein Phosphatase X, PP4, PPX, PP4C, PPH3, PPP4) (AP)
MBS6432733-01 0.1 mL

PPP4C (Serine/Threonine Protein Phosphatase 4 Catalytic Subunit, Protein Phosphatase X, PP4, PPX, PP4C, PPH3, PPP4) (AP)

Sign In for Pricing
View Details
PPP4C (Serine/Threonine Protein Phosphatase 4 Catalytic Subunit, Protein Phosphatase X, PP4, PPX, PP4C, PPH3, PPP4) (AP)
MBS6432733-02 5x 0.1 mL

PPP4C (Serine/Threonine Protein Phosphatase 4 Catalytic Subunit, Protein Phosphatase X, PP4, PPX, PP4C, PPH3, PPP4) (AP)

Sign In for Pricing
View Details
ZNF112 Rabbit Polyclonal Antibody (BF647)
orb2394275 100 µL

ZNF112 Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
Efcab11 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6676303 1.0 µg DNA

Efcab11 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details