Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Diphosphoinositol polyphosphate phosphohydrolase NUDT4B (NUD4B)

This Recombinant Human Diphosphoinositol polyphosphate phosphohydrolase NUDT4B (NUD4B) spans the amino acid sequence from region 1-181. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Diphosphoinositol polyphosphate phosphohydrolase NUDT4B; DIPP-2B; EC 3.6.1.52; Nucleoside diphosphate-linked moiety X motif 4B; Nudix motif 4B; Nudix hydrolase 4B; NUDT4B

UniProt

A0A024RBG1

Expression Region

1-181

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MMKFKPNQTRTYDREGFKKRAACLCFRSEQEDEVLLVSSSRYPDQWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGIFEQNQDRKHRTYVYVLTVTEILEDWEDSVNIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGCSPANGNSTVPSLPDNNALFVTAAQTSGLPSSVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Propanesulfonic Acid Sodium Salt
TRC-P839825-1G 1 g

2-Propanesulfonic Acid Sodium Salt

Sign In for Pricing
View Details
Histone H4 Polyclonal Antibody
E-AB-61560-01 60 µL

Histone H4 Polyclonal Antibody

Sign In for Pricing
View Details
Histone H4 Polyclonal Antibody
E-AB-61560-02 120 µL

Histone H4 Polyclonal Antibody

Sign In for Pricing
View Details
Histone H4 Polyclonal Antibody
E-AB-61560-03 200 µL

Histone H4 Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-Chk1 (S296) Recombinant Rabbit Monoclonal Antibody [SN06-50]
ET1611-76 100 µL

Phospho-Chk1 (S296) Recombinant Rabbit Monoclonal Antibody [SN06-50]

Sign In for Pricing
View Details
LIFR Antibody (Biotin)
KB-1915-01 50 μL

LIFR Antibody (Biotin)

Sign In for Pricing
View Details