Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 27 (TVA27)

This Recombinant Human T cell receptor alpha variable 27 (TVA27) spans the amino acid sequence from region 20-109. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 27 TRAV27

UniProt

A0A087WT01

Expression Region

20-109

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QLLEQSPQFLSIQEGENLTVYCNSSSVFSSLQWYRQEPGEGPVLLVTVVTGGEVKKLKRLTFQFGDARKDSSLHITAAQTGDTGLYLCAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aen (NM_001162939) Mouse Tagged ORF Clone Lentiviral Particle
MR217018L4V 200 µL

Aen (NM_001162939) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
NCU-G1 shRNA (m) Lentiviral Particles
sc-149860-V 200 µL

NCU-G1 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
DEPDC1B (XTP8, DEP Domain-containing Protein 1B, HBV X-transactivated Gene 8 Protein, HBV XAg-transactivated Protein 8, FLJ11252) (MaxLight 405)
MBS6189775-01 0.1 mL

DEPDC1B (XTP8, DEP Domain-containing Protein 1B, HBV X-transactivated Gene 8 Protein, HBV XAg-transactivated Protein 8, FLJ11252) (MaxLight 405)

Sign In for Pricing
View Details
DEPDC1B (XTP8, DEP Domain-containing Protein 1B, HBV X-transactivated Gene 8 Protein, HBV XAg-transactivated Protein 8, FLJ11252) (MaxLight 405)
MBS6189775-02 5x 0.1 mL

DEPDC1B (XTP8, DEP Domain-containing Protein 1B, HBV X-transactivated Gene 8 Protein, HBV XAg-transactivated Protein 8, FLJ11252) (MaxLight 405)

Sign In for Pricing
View Details
Cytokeratin 8 (CARD2, CK8, CYK8, CYKER, Cytokeratin Endo A, DreK8, EndoA, K2C8, K8, Keratin 8, Krt 2.8, KRT8, Type-II Keratin Kb8) (Biotin)
MBS6123030-01 0.1 mL

Cytokeratin 8 (CARD2, CK8, CYK8, CYKER, Cytokeratin Endo A, DreK8, EndoA, K2C8, K8, Keratin 8, Krt 2.8, KRT8, Type-II Keratin Kb8) (Biotin)

Sign In for Pricing
View Details
Cytokeratin 8 (CARD2, CK8, CYK8, CYKER, Cytokeratin Endo A, DreK8, EndoA, K2C8, K8, Keratin 8, Krt 2.8, KRT8, Type-II Keratin Kb8) (Biotin)
MBS6123030-02 5x 0.1 mL

Cytokeratin 8 (CARD2, CK8, CYK8, CYKER, Cytokeratin Endo A, DreK8, EndoA, K2C8, K8, Keratin 8, Krt 2.8, KRT8, Type-II Keratin Kb8) (Biotin)

Sign In for Pricing
View Details