Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 27 (TVA27)

This Recombinant Human T cell receptor alpha variable 27 (TVA27) spans the amino acid sequence from region 20-109. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 27 TRAV27

UniProt

A0A087WT01

Expression Region

20-109

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QLLEQSPQFLSIQEGENLTVYCNSSSVFSSLQWYRQEPGEGPVLLVTVVTGGEVKKLKRLTFQFGDARKDSSLHITAAQTGDTGLYLCAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AP2S1 Rabbit Monoclonal Antibody [KD Validation]
E51K61329 40 µL

AP2S1 Rabbit Monoclonal Antibody [KD Validation]

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) At4g16620 Polyclonal Antibody
MBS7147820 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) At4g16620 Polyclonal Antibody

Sign In for Pricing
View Details
[UL-13C6]galactitol
sc-363573 50 mg

[UL-13C6]galactitol

Sign In for Pricing
View Details
PSCA (11C9) Rabbit Monoclonal antibody
E28M1384 100 µL

PSCA (11C9) Rabbit Monoclonal antibody

Sign In for Pricing
View Details
GLC1H sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0863905 3x 1.0 µg

GLC1H sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
High Mobility Group Protein B1 (HMGB1) (MaxLight 750) discontinued
214889-ML750 100 µL

High Mobility Group Protein B1 (HMGB1) (MaxLight 750) discontinued

Sign In for Pricing
View Details