Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 26 (SIM26), partial

This Recombinant Human Small integral membrane protein 26 (SIM26), partial spans the amino acid sequence from region 36-95. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 26 SMIM26 LINC00493

UniProt

A0A096LP01

Expression Region

36-95

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AKSSVDQKDGSASEVPSELSERPKGFYVETVVTYKEDFVPNTEKILNYWKSWTGGPGTEP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELAVL4 Human shRNA Plasmid Kit (Locus ID 1996)
TL304798 1 Kit

ELAVL4 Human shRNA Plasmid Kit (Locus ID 1996)

Sign In for Pricing
View Details
Human NUP37 knockdown cell line
ABC-KD10438 1 Vial

Human NUP37 knockdown cell line

Sign In for Pricing
View Details
WRAP53 siRNA (Mouse)
orb1837216-01 15 nmol

WRAP53 siRNA (Mouse)

Sign In for Pricing
View Details
WRAP53 siRNA (Mouse)
orb1837216-02 30 nmol

WRAP53 siRNA (Mouse)

Sign In for Pricing
View Details
Human KLK1 ELISA kit (4X96T)
LF-EK50754 4×96T

Human KLK1 ELISA kit (4X96T)

Sign In for Pricing
View Details
Goat Anti-Human IgG H&L (Cy7), 1 pack = 500 µL
BAL6320 1 Each

Goat Anti-Human IgG H&L (Cy7), 1 pack = 500 µL

Sign In for Pricing
View Details