Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transcriptional regulator SEHBP (SEHBP)

This Recombinant Human Transcriptional regulator SEHBP (SEHBP) spans the amino acid sequence from region 1-46. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transcriptional regulator SEHBP; Short ORF-encoded histone-binding protein; ZNF689 upstream open reading frame protein; ZNF689

UniProt

C0HLU2

Expression Region

1-46

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MALRSIKSIAGSCLCSRQRRCGSSAAIFPEGIFRCLSPKFGQEFPE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Large Capacity Water Purification System BCPS-404
BCPS-404 1 Unit

Large Capacity Water Purification System BCPS-404

Sign In for Pricing
View Details
CellBrite® Steady 750 Membrane Staining Kit, 100 Labelings
#30141-T 1 Kit

CellBrite® Steady 750 Membrane Staining Kit, 100 Labelings

Sign In for Pricing
View Details
XRN1 Human Gene Knockout Kit (CRISPR)
KN221062LP 1 Kit

XRN1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
N-(2-Cyanoethyl)-N-ethylamine
TRC-C980045-500MG 500 mg

N-(2-Cyanoethyl)-N-ethylamine

Sign In for Pricing
View Details
Ticam1 Mouse Gene Knockout Kit (CRISPR)
KN517557 1 Kit

Ticam1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Semaphorin 4D (SEMA4D) Rabbit Monoclonal Antibody [Clone ID: R05-2E3]
TA385225 100 µL

Semaphorin 4D (SEMA4D) Rabbit Monoclonal Antibody [Clone ID: R05-2E3]

Sign In for Pricing
View Details