Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transcriptional regulator SEHBP (SEHBP)

This Recombinant Human Transcriptional regulator SEHBP (SEHBP) spans the amino acid sequence from region 1-46. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transcriptional regulator SEHBP; Short ORF-encoded histone-binding protein; ZNF689 upstream open reading frame protein; ZNF689

UniProt

C0HLU2

Expression Region

1-46

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MALRSIKSIAGSCLCSRQRRCGSSAAIFPEGIFRCLSPKFGQEFPE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WDR77 Mouse Monoclonal Antibody [Clone ID: OTI1F7]
CF809682 100 µg

WDR77 Mouse Monoclonal Antibody [Clone ID: OTI1F7]

Sign In for Pricing
View Details
P70 S6 Kinase beta (RPS6KB2) (NM_003952) Human Over-expression Lysate
LC401298 20 µg

P70 S6 Kinase beta (RPS6KB2) (NM_003952) Human Over-expression Lysate

Sign In for Pricing
View Details
Human ADCY2 (Adenylate Cyclase 2) CLIA Kit
E-CL-H0171-01 24 Tests

Human ADCY2 (Adenylate Cyclase 2) CLIA Kit

Sign In for Pricing
View Details
Human ADCY2 (Adenylate Cyclase 2) CLIA Kit
E-CL-H0171-02 48 Tests

Human ADCY2 (Adenylate Cyclase 2) CLIA Kit

Sign In for Pricing
View Details
Human ADCY2 (Adenylate Cyclase 2) CLIA Kit
E-CL-H0171-03 96 Tests

Human ADCY2 (Adenylate Cyclase 2) CLIA Kit

Sign In for Pricing
View Details
General Purpose Incubator BIGP-605
BIGP-605 1 Unit

General Purpose Incubator BIGP-605

Sign In for Pricing
View Details