Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human PTEN upstream open reading frame MP31 (MP31)

This Recombinant Human PTEN upstream open reading frame MP31 (MP31) spans the amino acid sequence from region 1-31. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PTEN upstream open reading frame MP31; Micropeptide 31; Mitochondrial lactate dehydrogenase regulator; MLDHR MP31

UniProt

C0HLV8

Expression Region

1-31

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MWRDSLCAAAGYALGAGTRLRSVLSSRKLQP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ILVBL Human shRNA Plasmid Kit (Locus ID 10994)
TR312154 1 Kit

ILVBL Human shRNA Plasmid Kit (Locus ID 10994)

Sign In for Pricing
View Details
TRIM39 Antibody
orb681949 100 µL

TRIM39 Antibody

Sign In for Pricing
View Details
LRRK1 Antibody, Biotin conjugated
CSB-PA655748LD01HU-01 50 µg

LRRK1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
LRRK1 Antibody, Biotin conjugated
CSB-PA655748LD01HU-02 100 µg

LRRK1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Tissue Inhibitor of Metalloproteinases 2 (TIMP2) (BSA & Azide Free) (HRP) discontinued
T5585-10AX-HRP 100 µL

Tissue Inhibitor of Metalloproteinases 2 (TIMP2) (BSA & Azide Free) (HRP) discontinued

Sign In for Pricing
View Details
Emp2 sgRNA CRISPR Lentivector (Rat) (Target 3)
K7309104 1.0 µg DNA

Emp2 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details