Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CNK3/IPCEF1 fusion protein (CNIPF), partial

This Recombinant Human CNK3/IPCEF1 fusion protein (CNIPF), partial spans the amino acid sequence from region 332-457. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CNK3/IPCEF1 fusion protein CNK3/IPCEF1

UniProt

G9CGD6

Expression Region

332-457

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

TSLKKEKSAILDLYIPPPPAVPYSPRDENGSFVYGGSSKCKQPLPGPKGSESPNSFLDQESRRRRFTIADSDQLPGYSVETNILPTKMREKTPSYGKPRPLSMPADGNWMGIVDPFARPRGHGRKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IgA Secretory Component (SC05), CF640R conjugate, 0.1mg/mL
BNC400050-100 1x 100 µL

IgA Secretory Component (SC05), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF740 conjugate, 0.1mg/mL
BNC741035-500 1x 500 µL

CD8 (C8/1035), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF647 conjugate, 0.1mg/mL
BNC470342-500 1x 500 µL

CD43 (84-3C1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF770 conjugate, 0.1mg/mL
BNC701052-500 1x 500 µL

CD3e (B-B12), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF647 conjugate, 0.1mg/mL
BNC470181-100 1x 100 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF488A conjugate, 0.1mg/mL
BNC880039-500 1x 500 µL

CD34 (ICO-115), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details