Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Piercer of microtubule wall 2 protein (PIRC2)

This Recombinant Human Piercer of microtubule wall 2 protein (PIRC2) spans the amino acid sequence from region 1-121. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Piercer of microtubule wall 2 protein PIERCE2 C15orf65

UniProt

H3BRN8

Expression Region

1-121

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MTDRNRDKKSTSPSNSDTEMKSEQLPPCVNPGNPVFSCMLDPKTLQTATSLSKPQMIMYKTNSSHYGEFLPIPQFFPCNYTPKEQVFSSHIRATGFYQNNTLNTAPDRTRTLDFPNIQHTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF568 conjugate, 0.1mg/mL
BNC681073-100 1x 100 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF405S conjugate, 0.1mg/mL
BNC040305-500 1x 500 µL

CD95 (B-R18), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF640R conjugate, 0.1mg/mL
BNC400352-100 1x 100 µL

CD31 / PECAM-1 (158-2B3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF640R conjugate, 0.1mg/mL
BNC400871-500 1x 500 µL

CD71 (66IG10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF488A conjugate, 0.1mg/mL
BNC880676-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MMP9 (rMMP9/1769), CF647 conjugate, 0.1mg/mL
BNC472176-100 1x 100 µL

MMP9 (rMMP9/1769), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details