Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Medium-wave-sensitive opsin 3 (OPSG3), partial

This Recombinant Human Medium-wave-sensitive opsin 3 (OPSG3), partial spans the amino acid sequence from region 1-52. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Medium-wave-sensitive opsin 3; Green cone photoreceptor pigment; Green-sensitive opsin; GOP; opsin 1 cone pigments medium-wave-sensitive 3; OPN1MW3

UniProt

P0DN78

Expression Region

1-52

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAQQWSLQRLAGRHPQDSYEDSTQSSIFTYTNSNSTRGPFEGPNYHIAPRWV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LIPN, CT (LIPN, LIPL4, Lipase member N, Lipase-like abhydrolase domain-containing protein 4) (MaxLight 490)
MBS6316466-01 0.1 mL

LIPN, CT (LIPN, LIPL4, Lipase member N, Lipase-like abhydrolase domain-containing protein 4) (MaxLight 490)

Sign In for Pricing
View Details
LIPN, CT (LIPN, LIPL4, Lipase member N, Lipase-like abhydrolase domain-containing protein 4) (MaxLight 490)
MBS6316466-02 5x 0.1 mL

LIPN, CT (LIPN, LIPL4, Lipase member N, Lipase-like abhydrolase domain-containing protein 4) (MaxLight 490)

Sign In for Pricing
View Details
Mouse Monoclonal Filaggrin Antibody (FLG/1563) [PE]
NBP2-75774PE 0.1 mL

Mouse Monoclonal Filaggrin Antibody (FLG/1563) [PE]

Sign In for Pricing
View Details
BUD13 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV634332 1.0 µg DNA

BUD13 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
1-Docosanol-d45
TRC-D678857-250MG 250 mg

1-Docosanol-d45

Sign In for Pricing
View Details
PDSS1 Protein Vector (Human) (pPB-N-His)
PV110327 500 ng

PDSS1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details