Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Medium-wave-sensitive opsin 3 (OPSG3), partial

This Recombinant Human Medium-wave-sensitive opsin 3 (OPSG3), partial spans the amino acid sequence from region 1-52. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Medium-wave-sensitive opsin 3; Green cone photoreceptor pigment; Green-sensitive opsin; GOP; opsin 1 cone pigments medium-wave-sensitive 3; OPN1MW3

UniProt

P0DN78

Expression Region

1-52

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAQQWSLQRLAGRHPQDSYEDSTQSSIFTYTNSNSTRGPFEGPNYHIAPRWV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD36 Recombinant Rabbit monoclonal Antibody [JJ2005]
ET1701-24-50UL 50 µL

CD36 Recombinant Rabbit monoclonal Antibody [JJ2005]

Sign In for Pricing
View Details
SR 2640 hydrochloride
E2671-5mg 5 mg

SR 2640 hydrochloride

Sign In for Pricing
View Details
IL27 Rabbit Polyclonal Antibody
TA306316 100 µg

IL27 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human VSNL1 sgRNA gene knockout kit - Lentiviral human VSNL1 sgRNA gene knockout kit (25)
GTR15391173 1 Vial

Lentiviral human VSNL1 sgRNA gene knockout kit - Lentiviral human VSNL1 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
2-Amino-3-chlorobenzoic Acid
TRC-A603395-10G 10 g

2-Amino-3-chlorobenzoic Acid

Sign In for Pricing
View Details
Recombinant Pseudomonas Aeruginosa serC Protein (aa 1-361) (strain LESB58)
VAng-Cr0920-50gEcoli 50 µg (E. coli)

Recombinant Pseudomonas Aeruginosa serC Protein (aa 1-361) (strain LESB58)

Sign In for Pricing
View Details