Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Choriogonadotropin subunit beta 7 (CGB7)

This Recombinant Human Choriogonadotropin subunit beta 7 (CGB7) spans the amino acid sequence from region 21-165. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Choriogonadotropin subunit beta 7 CGB7

UniProt

P0DN87

Expression Region

21-165

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SREMLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQASSSSKAPPPSLPSPSRLPGPSDTPILPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ATE1 Antibody Picoband®, FITC Conjugate
A07459-1-FITC 100 µg/Vial

Anti-ATE1 Antibody Picoband®, FITC Conjugate

Sign In for Pricing
View Details
Tor2a (NM_152800) Mouse Tagged ORF Clone
MG204635 10 µg

Tor2a (NM_152800) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Polyclonal Antibody to Alanine Glyoxylate Aminotransferase 2 (AGXT2)
TRV-0046679-01 20 µL

Polyclonal Antibody to Alanine Glyoxylate Aminotransferase 2 (AGXT2)

Sign In for Pricing
View Details
Polyclonal Antibody to Alanine Glyoxylate Aminotransferase 2 (AGXT2)
TRV-0046679-02 100 µL

Polyclonal Antibody to Alanine Glyoxylate Aminotransferase 2 (AGXT2)

Sign In for Pricing
View Details
Polyclonal Antibody to Alanine Glyoxylate Aminotransferase 2 (AGXT2)
TRV-0046679-03 200 µL

Polyclonal Antibody to Alanine Glyoxylate Aminotransferase 2 (AGXT2)

Sign In for Pricing
View Details
Polyclonal Antibody to Alanine Glyoxylate Aminotransferase 2 (AGXT2)
TRV-0046679-04 1 mL

Polyclonal Antibody to Alanine Glyoxylate Aminotransferase 2 (AGXT2)

Sign In for Pricing
View Details