Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin heavy variable 1-38-4 (HV384)

This Recombinant Human Probable non-functional immunoglobulin heavy variable 1-38-4 (HV384) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin heavy variable 1-38-4 IGHV1-38-4 IGHV1-C

UniProt

P0DTW3

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSWAEVRKSGASVKVSCSFSGFTITSYGIHWVQQSPGQGLEWMGWINPGNGSPSYAKKFQGRFTMTRDMSTTTAYTDLSSLTSEDMAVYYYAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HA tag, AlpHcAbs® Rabbit antibody (HRP)
HA710114 100 µg

HA tag, AlpHcAbs® Rabbit antibody (HRP)

Sign In for Pricing
View Details
Centrin 1 (CETN1) (NM_004066) Human Recombinant Protein
TP306285M 100 µg

Centrin 1 (CETN1) (NM_004066) Human Recombinant Protein

Sign In for Pricing
View Details
C10orf55 (NM_001001791) Human Over-expression Lysate
LC424244 20 µg

C10orf55 (NM_001001791) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Mouse TNFSF18 Protein (His Tag)
PDMM100087-01 20 µg

Recombinant Mouse TNFSF18 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse TNFSF18 Protein (His Tag)
PDMM100087-02 100 µg

Recombinant Mouse TNFSF18 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse TNFSF18 Protein (His Tag)
PDMM100087-03 500 µg

Recombinant Mouse TNFSF18 Protein (His Tag)

Sign In for Pricing
View Details