Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin heavy variable 1-38-4 (HV384)

This Recombinant Human Probable non-functional immunoglobulin heavy variable 1-38-4 (HV384) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin heavy variable 1-38-4 IGHV1-38-4 IGHV1-C

UniProt

P0DTW3

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSWAEVRKSGASVKVSCSFSGFTITSYGIHWVQQSPGQGLEWMGWINPGNGSPSYAKKFQGRFTMTRDMSTTTAYTDLSSLTSEDMAVYYYAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nicotinuric Acid-d4
TRC-N433502-2.5MG 2.5 mg

Nicotinuric Acid-d4

Sign In for Pricing
View Details
SEC14L4 (NM_174977) Human Recombinant Protein
TP321251L 1 mg

SEC14L4 (NM_174977) Human Recombinant Protein

Sign In for Pricing
View Details
Galectin 7 (LGALS7B) (NM_001042507) Human Over-expression Lysate
LC420948 20 µg

Galectin 7 (LGALS7B) (NM_001042507) Human Over-expression Lysate

Sign In for Pricing
View Details
Alpha smooth muscle Actin Recombinant Chimeric Antibody Antibody
HA601546 100 µL

Alpha smooth muscle Actin Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
8-Oxoguanine DNA Glycosylase (CPTC-OGG1-1), 1mg/mL
BNUM2251-50 1x 50 µL

8-Oxoguanine DNA Glycosylase (CPTC-OGG1-1), 1mg/mL

Sign In for Pricing
View Details
Recombinant GNAQ Antibody
RC-4832-01 50 μL

Recombinant GNAQ Antibody

Sign In for Pricing
View Details