Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ribosome biogenesis inhibitor MINAS-60 (MNS60)

This Recombinant Human Ribosome biogenesis inhibitor MINAS-60 (MNS60) spans the amino acid sequence from region 1-130. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ribosome biogenesis inhibitor MINAS-60; MINAS-60; RBM10

UniProt

P0DW28

Expression Region

1-130

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery; Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MKDVVVVVTGLAAMEPLTARRMMVGRTAAETTTTGTWTTVHILASMAARRASMTMTTHLRSRVRRIPTRPPRAPRLSVGGGGGTGTAPPARQASPETATIGTRTIGPSKGRRRRRRRMRRRRRRPVTSSC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TACSTD2 / TROP2 (Epithelial Marker) (TACSTD2/2152), CF740 conjugate, 0.1mg/mL
BNC742152-500 1x 500 µL

TACSTD2 / TROP2 (Epithelial Marker) (TACSTD2/2152), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thyroglobulin (Thyroidal Cell Marker) (TGB/1970R), 0.2mg/mL
BNUB1970-100 1x 100 µL

Thyroglobulin (Thyroidal Cell Marker) (TGB/1970R), 0.2mg/mL

Sign In for Pricing
View Details
elF2 alpha (EIF2S1) Rabbit Polyclonal Antibody
TA375800 100 µL

elF2 alpha (EIF2S1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
UBXN2A (NM_181713) Human Recombinant Protein
TP310524M 100 µg

UBXN2A (NM_181713) Human Recombinant Protein

Sign In for Pricing
View Details
Human MUC5B activation kit by CRISPRa
GA118892 1 Kit

Human MUC5B activation kit by CRISPRa

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF568 conjugate, 0.1mg/mL
BNC680257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details