Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Poly-ADP-ribosylation-amplifying and CtIP-maintaining micropeptide (PACMP)

This Recombinant Human Poly-ADP-ribosylation-amplifying and CtIP-maintaining micropeptide (PACMP) spans the amino acid sequence from region 1-44. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Poly-ADP-ribosylation-amplifying and CtIP-maintaining micropeptide; PAR-amplifying and CtIP-maintaining micropeptide; MARCHF6-DT PACMP

UniProt

P0DW81

Expression Region

1-44

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAASGGTKKAQSGGRRLREPSSRPSRRARQRPRRGALRKAGRFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Shigella flexneri Uncharacterized lipoprotein ygdR (ygdR)
MBS1056851-01 0.02 mg (E-Coli)

Recombinant Shigella flexneri Uncharacterized lipoprotein ygdR (ygdR)

Sign In for Pricing
View Details
Recombinant Shigella flexneri Uncharacterized lipoprotein ygdR (ygdR)
MBS1056851-02 0.1 mg (E-Coli)

Recombinant Shigella flexneri Uncharacterized lipoprotein ygdR (ygdR)

Sign In for Pricing
View Details
Recombinant Shigella flexneri Uncharacterized lipoprotein ygdR (ygdR)
MBS1056851-03 0.02 mg (Yeast)

Recombinant Shigella flexneri Uncharacterized lipoprotein ygdR (ygdR)

Sign In for Pricing
View Details
Recombinant Shigella flexneri Uncharacterized lipoprotein ygdR (ygdR)
MBS1056851-04 0.1 mg (Yeast)

Recombinant Shigella flexneri Uncharacterized lipoprotein ygdR (ygdR)

Sign In for Pricing
View Details
Recombinant Shigella flexneri Uncharacterized lipoprotein ygdR (ygdR)
MBS1056851-05 0.02 mg (Baculovirus)

Recombinant Shigella flexneri Uncharacterized lipoprotein ygdR (ygdR)

Sign In for Pricing
View Details
Recombinant Shigella flexneri Uncharacterized lipoprotein ygdR (ygdR)
MBS1056851-06 1 mg (E-Coli)

Recombinant Shigella flexneri Uncharacterized lipoprotein ygdR (ygdR)

Sign In for Pricing
View Details