Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Armadillo repeat-containing X-linked protein 3 (ARMX3), partial

This Recombinant Human Armadillo repeat-containing X-linked protein 3 (ARMX3), partial spans the amino acid sequence from region 30-379. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Armadillo repeat-containing X-linked protein 3; ARM protein lost in epithelial cancers on chromosome X 3; Protein ALEX3; ARMCX3 ALEX3 BM-017 UNQ2517/PRO6007

UniProt

Q9UH62

Expression Region

30-379

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GRKQNKEKMAEGGSGDVDDAGDCSGARYNDWSDDDDDSNESKSIVWYPPWARIGTEAGTRARARARARATRARRAVQKRASPNSDDTVLSPQELQKVLCLVEMSEKPYILEAALIALGNNAAYAFNRDIIRDLGGLPIVAKILNTRDPIVKEKALIVLNNLSVNAENQRRLKVYMNQVCDDTITSRLNSSVQLAGLRLLTNMTVTNEYQHMLANSISDFFRLFSAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKENKEVILKLLVIFENINDNFKWEENEPTQNQFGEGSLFFFLKEFQVCADKVLGIESHHDFLVKVKVGKFMAKLAEHMFPKSQE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Lung
CS624929 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Myristoyl-L-carnitine Hydrochloride
TRC-M884745-1G 1 g

Myristoyl-L-carnitine Hydrochloride

Sign In for Pricing
View Details
Frozen Tissue Sections, Uterus
CS507991 5x 5 µm

Frozen Tissue Sections, Uterus

Sign In for Pricing
View Details
CPE Antibody
OC-320-01 50 μL

CPE Antibody

Sign In for Pricing
View Details
CPE Antibody
OC-320-02 100 µL

CPE Antibody

Sign In for Pricing
View Details
CPE Antibody
OC-320-03 1 mL

CPE Antibody

Sign In for Pricing
View Details