Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Centrosomal protein of 170 kDa protein B (C170B), partial

This Recombinant Human Centrosomal protein of 170 kDa protein B (C170B), partial spans the amino acid sequence from region 23-73. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Centrosomal protein of 170 kDa protein B; Centrosomal protein 170B; Cep170B; CEP170B FAM68C KIAA0284

UniProt

Q9Y4F5

Expression Region

23-73

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

IFVGREECELMLQSRSVDKQHAVINYDQDRDEHWVKDLGSLNGTFVNDMRI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,2,3,4-Tetrahydroquinoline-7-sulfonamide
HCC23887-01 100 mg

1,2,3,4-Tetrahydroquinoline-7-sulfonamide

Sign In for Pricing
View Details
1,2,3,4-Tetrahydroquinoline-7-sulfonamide
HCC23887-02 1 g

1,2,3,4-Tetrahydroquinoline-7-sulfonamide

Sign In for Pricing
View Details
CCDC93 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A10]
TA800470BM 100 µL

CCDC93 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A10]

Sign In for Pricing
View Details
Human IGFBP-3 Antibody
32590-05111 150 µg

Human IGFBP-3 Antibody

Sign In for Pricing
View Details
SIX1 (Homeobox Protein SIX1, Sine Oculis Homeobox Homolog 1) (Biotin)
133374-Biotin 100 µL

SIX1 (Homeobox Protein SIX1, Sine Oculis Homeobox Homolog 1) (Biotin)

Sign In for Pricing
View Details
FAK (Ab-576/577) Antibody
orb14730-01 50 μL

FAK (Ab-576/577) Antibody

Sign In for Pricing
View Details