Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human BTB/POZ domain-containing protein KCTD3 (KCTD3), partial

This Recombinant Human BTB/POZ domain-containing protein KCTD3 (KCTD3), partial spans the amino acid sequence from region 18-87. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BTB/POZ domain-containing protein KCTD3; Renal carcinoma antigen NY-REN-45; KCTD3

UniProt

Q9Y597

Expression Region

18-87

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EIVQLNVGGTRFSTSRQTLMWIPDSFFSSLLSGRISTLRDETGAIFIDRDPAAFAPILNFLRTKELDLRG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat A Disintegrin And Metalloproteinase With Thrombospondin 5 (ADAMTS5) ELISA Kit
RD-ADAMTS5-Ra-01 96 Tests

Rat A Disintegrin And Metalloproteinase With Thrombospondin 5 (ADAMTS5) ELISA Kit

Sign In for Pricing
View Details
Rat A Disintegrin And Metalloproteinase With Thrombospondin 5 (ADAMTS5) ELISA Kit
RD-ADAMTS5-Ra-02 48 Tests

Rat A Disintegrin And Metalloproteinase With Thrombospondin 5 (ADAMTS5) ELISA Kit

Sign In for Pricing
View Details
CDC42 Rabbit mAb
E45R12871N-50 50 µL

CDC42 Rabbit mAb

Sign In for Pricing
View Details
Anti-SGSM1
orb1133144 100 µL

Anti-SGSM1

Sign In for Pricing
View Details
V5-tag Protein IP Assay Kit with Magnetic Beads
P2187S 20 - 100 Tests

V5-tag Protein IP Assay Kit with Magnetic Beads

Sign In for Pricing
View Details
Mouse Gfra1 / GDNF family receptor alpha-1 Recombinant Protein
R2753m 1 Each

Mouse Gfra1 / GDNF family receptor alpha-1 Recombinant Protein

Sign In for Pricing
View Details