Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin kappa variable 1D-42 (KVD42)

This Recombinant Human Probable non-functional immunoglobulin kappa variable 1D-42 (KVD42) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin kappa variable 1D-42 IGKV1D-42

UniProt

A0A075B6H8

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIQMTQSPSFLSASVGDRVSIICWASEGISSNLAWYLQKPGKSPKLFLYDAKDLHPGVSSRFSGRGSGTDFTLTIISLKPEDFAAYYCKQDFSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCN7A siRNA (Human)
orb1863990-01 15 nmol

SCN7A siRNA (Human)

Sign In for Pricing
View Details
SCN7A siRNA (Human)
orb1863990-02 30 nmol

SCN7A siRNA (Human)

Sign In for Pricing
View Details
FRS2 Antibody, HRP conjugated
A22455-100UG 100 µg

FRS2 Antibody, HRP conjugated

Sign In for Pricing
View Details
RNF25 (NM_022453) Human Over-expression Lysate
LS064320-100ug 100 µg

RNF25 (NM_022453) Human Over-expression Lysate

Sign In for Pricing
View Details
hsa-miR-3150b-3p Primers
MPH02444 150 µL / 10 µM

hsa-miR-3150b-3p Primers

Sign In for Pricing
View Details
BMP4 Conjugated Antibody
C35652 100 µL

BMP4 Conjugated Antibody

Sign In for Pricing
View Details