Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 4-69 (LV469)

This Recombinant Human Immunoglobulin lambda variable 4-69 (LV469) spans the amino acid sequence from region 21-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 4-69 IGLV4-69

UniProt

A0A075B6H9

Expression Region

21-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QLVLTQSPSASASLGASVKLTCTLSSGHSSYAIAWHQQQPEKGPRYLMKLNSDGSHSKGDGIPDRFSGSSSGAERYLTISSLQSEDEADYYCQTWGTGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human herpesvirus 2 Envelope glycoprotein C (gC)
CSB-CF804110HJX (A4)-01 20 µg

Recombinant Human herpesvirus 2 Envelope glycoprotein C (gC)

Sign In for Pricing
View Details
Recombinant Human herpesvirus 2 Envelope glycoprotein C (gC)
CSB-CF804110HJX (A4)-02 100 µg

Recombinant Human herpesvirus 2 Envelope glycoprotein C (gC)

Sign In for Pricing
View Details
Recombinant Mouse Beta-adrenergic receptor kinase 1 (Adrbk1)
MBS9423918-01 0.02 mg

Recombinant Mouse Beta-adrenergic receptor kinase 1 (Adrbk1)

Sign In for Pricing
View Details
Recombinant Mouse Beta-adrenergic receptor kinase 1 (Adrbk1)
MBS9423918-02 0.1 mg

Recombinant Mouse Beta-adrenergic receptor kinase 1 (Adrbk1)

Sign In for Pricing
View Details
Recombinant Mouse Beta-adrenergic receptor kinase 1 (Adrbk1)
MBS9423918-03 1 mg

Recombinant Mouse Beta-adrenergic receptor kinase 1 (Adrbk1)

Sign In for Pricing
View Details
Recombinant Mouse Beta-adrenergic receptor kinase 1 (Adrbk1)
MBS9423918-04 5x 1 mg

Recombinant Mouse Beta-adrenergic receptor kinase 1 (Adrbk1)

Sign In for Pricing
View Details