Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 4-69 (LV469)

This Recombinant Human Immunoglobulin lambda variable 4-69 (LV469) spans the amino acid sequence from region 21-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 4-69 IGLV4-69

UniProt

A0A075B6H9

Expression Region

21-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QLVLTQSPSASASLGASVKLTCTLSSGHSSYAIAWHQQQPEKGPRYLMKLNSDGSHSKGDGIPDRFSGSSSGAERYLTISSLQSEDEADYYCQTWGTGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Defb12 Mouse shRNA Lentiviral Particle (Locus ID 77674)
TL519688V 500 µL Each

Defb12 Mouse shRNA Lentiviral Particle (Locus ID 77674)

Sign In for Pricing
View Details
Cavy Caspase 2 ELISA Kit
MBS009527 Inquire

Cavy Caspase 2 ELISA Kit

Sign In for Pricing
View Details
Casein Kinase Iδ rabbit pAb
ES4858-01 50 µL

Casein Kinase Iδ rabbit pAb

Sign In for Pricing
View Details
Casein Kinase Iδ rabbit pAb
ES4858-02 100 µL

Casein Kinase Iδ rabbit pAb

Sign In for Pricing
View Details
NDUFA12 Rabbit pAb
E2508237 100 µL

NDUFA12 Rabbit pAb

Sign In for Pricing
View Details
AM 281
ALX-270-240-M005 5 mg

AM 281

Sign In for Pricing
View Details