Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 8-61 (LV861)

This Recombinant Human Immunoglobulin lambda variable 8-61 (LV861) spans the amino acid sequence from region 25-122. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 8-61 IGLV8-61

UniProt

A0A075B6I0

Expression Region

25-122

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QTVVTQEPSFSVSPGGTVTLTCGLSSGSVSTSYYPSWYQQTPGQAPRTLIYSTNTRSSGVPDRFSGSILGNKAALTITGAQADDESDYYCVLYMGSGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYOM2 Protein Vector (Mouse) (pPM-C-His)
PV203717 500 ng

MYOM2 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
LIR-7 (CD85 Antigen-like Family Member H, CD85h, ILT-1, ILT1, Immunoglobulin like transcript 1, Immunoglobulin-like transcript 1, Leukocyte immunoglobulin like Receptor 7, Leukocyte immunoglobulin like Receptor SubFamily A Member 2, Leukocyte immunoglobulin-like Receptor 7, Leukocyte immunoglobulin-like Receptor SubFamily A Member 2, LILRA2, LIR-7, LIR7, LIRA2) discontinued
223923-01 50 µL

LIR-7 (CD85 Antigen-like Family Member H, CD85h, ILT-1, ILT1, Immunoglobulin like transcript 1, Immunoglobulin-like transcript 1, Leukocyte immunoglobulin like Receptor 7, Leukocyte immunoglobulin like Receptor SubFamily A Member 2, Leukocyte immunoglobulin-like Receptor 7, Leukocyte immunoglobulin-like Receptor SubFamily A Member 2, LILRA2, LIR-7, LIR7, LIRA2) discontinued

Sign In for Pricing
View Details
LIR-7 (CD85 Antigen-like Family Member H, CD85h, ILT-1, ILT1, Immunoglobulin like transcript 1, Immunoglobulin-like transcript 1, Leukocyte immunoglobulin like Receptor 7, Leukocyte immunoglobulin like Receptor SubFamily A Member 2, Leukocyte immunoglobulin-like Receptor 7, Leukocyte immunoglobulin-like Receptor SubFamily A Member 2, LILRA2, LIR-7, LIR7, LIRA2) discontinued
223923-02 100 µL

LIR-7 (CD85 Antigen-like Family Member H, CD85h, ILT-1, ILT1, Immunoglobulin like transcript 1, Immunoglobulin-like transcript 1, Leukocyte immunoglobulin like Receptor 7, Leukocyte immunoglobulin like Receptor SubFamily A Member 2, Leukocyte immunoglobulin-like Receptor 7, Leukocyte immunoglobulin-like Receptor SubFamily A Member 2, LILRA2, LIR-7, LIR7, LIRA2) discontinued

Sign In for Pricing
View Details
ERBB4
MBS8560358-01 0.2 mL

ERBB4

Sign In for Pricing
View Details
ERBB4
MBS8560358-02 0.1 mL (AF405L)

ERBB4

Sign In for Pricing
View Details
ERBB4
MBS8560358-03 0.1 mL (AF405S)

ERBB4

Sign In for Pricing
View Details