Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 4-60 (LV460)

This Recombinant Human Immunoglobulin lambda variable 4-60 (LV460) spans the amino acid sequence from region 22-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 4-60 IGLV4-60

UniProt

A0A075B6I1

Expression Region

22-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QPVLTQSSSASASLGSSVKLTCTLSSGHSSYIIAWHQQQPGKAPRYLMKLEGSGSYNKGSGVPDRFSGSSSGADRYLTISNLQFEDEADYYCETWDSNT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal TGF-beta 2 Antibody (TGFB2/1679) [mFluor Violet 500 SE]
NBP3-27016MFV500 0.1 mL

Mouse Monoclonal TGF-beta 2 Antibody (TGFB2/1679) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
Rabbit Polyclonal beta Tubulin Antibody
NB100-56459SS 0.025 mg

Rabbit Polyclonal beta Tubulin Antibody

Sign In for Pricing
View Details
Connexin-32 Polyclonal Antibody, RBITC Conjugated
bs-1376R-RBITC 100 µL

Connexin-32 Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
PLV2-CMV-FABP4-3xFLAG-ZsGreen1-Puro Plasmid
PVT66129 2 µg

PLV2-CMV-FABP4-3xFLAG-ZsGreen1-Puro Plasmid

Sign In for Pricing
View Details
Ac-Phe-Gly-pNA
HY-148415 1 Each

Ac-Phe-Gly-pNA

Sign In for Pricing
View Details
Anti-FKBP52/FKBP4 Antibody Picoband®, FITC Conjugate
A02165-3-FITC 100 µg/Vial

Anti-FKBP52/FKBP4 Antibody Picoband®, FITC Conjugate

Sign In for Pricing
View Details