Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 4-60 (LV460)

This Recombinant Human Immunoglobulin lambda variable 4-60 (LV460) spans the amino acid sequence from region 22-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 4-60 IGLV4-60

UniProt

A0A075B6I1

Expression Region

22-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QPVLTQSSSASASLGSSVKLTCTLSSGHSSYIIAWHQQQPGKAPRYLMKLEGSGSYNKGSGVPDRFSGSSSGADRYLTISNLQFEDEADYYCETWDSNT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD151 (CD151 Molecule (Raph Blood Group), GP27, MER2, PETA-3, RAPH, SFA1, TSPAN24) (PE)
MBS6187320-01 0.1 mL

CD151 (CD151 Molecule (Raph Blood Group), GP27, MER2, PETA-3, RAPH, SFA1, TSPAN24) (PE)

Sign In for Pricing
View Details
CD151 (CD151 Molecule (Raph Blood Group), GP27, MER2, PETA-3, RAPH, SFA1, TSPAN24) (PE)
MBS6187320-02 5x 0.1 mL

CD151 (CD151 Molecule (Raph Blood Group), GP27, MER2, PETA-3, RAPH, SFA1, TSPAN24) (PE)

Sign In for Pricing
View Details
PrV gE Mouse mAb
orb3184673-01 50 µL

PrV gE Mouse mAb

Sign In for Pricing
View Details
PrV gE Mouse mAb
orb3184673-02 100 µL

PrV gE Mouse mAb

Sign In for Pricing
View Details
PrV gE Mouse mAb
orb3184673-03 200 µL

PrV gE Mouse mAb

Sign In for Pricing
View Details
Anti-Phospho-IRP-1 (S711) antibody
STJ90914 200 µl

Anti-Phospho-IRP-1 (S711) antibody

Sign In for Pricing
View Details