Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 4-60 (LV460)

This Recombinant Human Immunoglobulin lambda variable 4-60 (LV460) spans the amino acid sequence from region 22-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 4-60 IGLV4-60

UniProt

A0A075B6I1

Expression Region

22-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QPVLTQSSSASASLGSSVKLTCTLSSGHSSYIIAWHQQQPGKAPRYLMKLEGSGSYNKGSGVPDRFSGSSSGADRYLTISNLQFEDEADYYCETWDSNT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

miniPURE-EVs: Size exclusion chromatography column
HBM-mPEV-10 10 Columns

miniPURE-EVs: Size exclusion chromatography column

Sign In for Pricing
View Details
PPAR-γ rabbit pAb
ES3251-01 50 µL

PPAR-γ rabbit pAb

Sign In for Pricing
View Details
PPAR-γ rabbit pAb
ES3251-02 100 µL

PPAR-γ rabbit pAb

Sign In for Pricing
View Details
Bovine Anti-Centrol And Centrosome Antibody ACA ELISA Kit
BG-BVN10232 1 Each

Bovine Anti-Centrol And Centrosome Antibody ACA ELISA Kit

Sign In for Pricing
View Details
EPHA10 (Ephrin Type-A Receptor 10)
MBS6507430-01 0.1 mg

EPHA10 (Ephrin Type-A Receptor 10)

Sign In for Pricing
View Details
EPHA10 (Ephrin Type-A Receptor 10)
MBS6507430-02 5x 0.1 mg

EPHA10 (Ephrin Type-A Receptor 10)

Sign In for Pricing
View Details