Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin lambda variable 11-55 (LVK55)

This Recombinant Human Probable non-functional immunoglobulin lambda variable 11-55 (LVK55) spans the amino acid sequence from region 20-123. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin lambda variable 11-55 IGLV11-55

UniProt

A0A075B6I3

Expression Region

20-123

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RPVLTQPPSLSASPGATARLPCTLSSDLSVGGKNMFWYQQKLGSSPRLFLYHYSDSDKQLGPGVPSRVSGSKETSSNTAFLLISGLQPEDEADYYCQVYESSAN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FluoBolt Noggin Fluorescence Immunoassay
FIA-1701 1 Each

FluoBolt Noggin Fluorescence Immunoassay

Sign In for Pricing
View Details
PCMV-TRA2B-3UTR-3xFLAG-Neo Plasmid
PVT82657 2 µg

PCMV-TRA2B-3UTR-3xFLAG-Neo Plasmid

Sign In for Pricing
View Details
Recombinant Canine Lymphocyte Activating 3 (LAG3), C-His
AP7F488 100 µg

Recombinant Canine Lymphocyte Activating 3 (LAG3), C-His

Sign In for Pricing
View Details
2,6-Dimethoxypyridine-3-boronic acid
274339-01 500 mg

2,6-Dimethoxypyridine-3-boronic acid

Sign In for Pricing
View Details
2,6-Dimethoxypyridine-3-boronic acid
274339-02 1 g

2,6-Dimethoxypyridine-3-boronic acid

Sign In for Pricing
View Details
2,6-Dimethoxypyridine-3-boronic acid
274339-03 2 g

2,6-Dimethoxypyridine-3-boronic acid

Sign In for Pricing
View Details