Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 10-54 (LVX54)

This Recombinant Human Immunoglobulin lambda variable 10-54 (LVX54) spans the amino acid sequence from region 22-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 10-54 IGLV10-54

UniProt

A0A075B6I4

Expression Region

22-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GLTQPPSVSKGLRQTATLTCTGNSNIVGNQGAAWLQQHQGHPPKLLSYRNNNRPSGISERFSASRSGNTASLTITGLQPEDEADYYCSALDSSLSA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C- (ApUp)
BLG-C357-01 1 μmoL

C- (ApUp)

Sign In for Pricing
View Details
H-FABP Rabbit mAb
C06616-20uL 20 µL

H-FABP Rabbit mAb

Sign In for Pricing
View Details
PCNA Polyclonal Antibody
NHP-AB414 Each

PCNA Polyclonal Antibody

Sign In for Pricing
View Details
pCMV-SPORT6-Vps26c Plasmid
PVT53162 2 µg

pCMV-SPORT6-Vps26c Plasmid

Sign In for Pricing
View Details
PPP1CB Peptide - C-terminal region (AAP65811)
AAP65811-100UG 100 µg

PPP1CB Peptide - C-terminal region (AAP65811)

Sign In for Pricing
View Details
N- (3-Hydroxypropyl) carbamic acid benzyl ester
HY-W039951 1 Each

N- (3-Hydroxypropyl) carbamic acid benzyl ester

Sign In for Pricing
View Details