Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 10-54 (LVX54)

This Recombinant Human Immunoglobulin lambda variable 10-54 (LVX54) spans the amino acid sequence from region 22-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 10-54 IGLV10-54

UniProt

A0A075B6I4

Expression Region

22-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GLTQPPSVSKGLRQTATLTCTGNSNIVGNQGAAWLQQHQGHPPKLLSYRNNNRPSGISERFSASRSGNTASLTITGLQPEDEADYYCSALDSSLSA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NAG Recombinant Protein Antigen
NBP1-92164PEP 0.1 mL

NAG Recombinant Protein Antigen

Sign In for Pricing
View Details
Ddx60 3'UTR GFP Stable Cell Line
TU253278 1.0 mL

Ddx60 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
CSMD1 (NM_033225) Human Tagged ORF Clone
RG223813 10 µg

CSMD1 (NM_033225) Human Tagged ORF Clone

Sign In for Pricing
View Details
Wall holder for cleaning paper
SUPMURAL 1 Piece

Wall holder for cleaning paper

Sign In for Pricing
View Details
Bovine GDF9 / Growth/differentiation factor 9 Recombinant Protein
R0427b 1 Each

Bovine GDF9 / Growth/differentiation factor 9 Recombinant Protein

Sign In for Pricing
View Details
HDAC1 (Histone Deacetylase 1)
482584 100 µL

HDAC1 (Histone Deacetylase 1)

Sign In for Pricing
View Details