Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin lambda variable 1-50 (LV150)

This Recombinant Human Probable non-functional immunoglobulin lambda variable 1-50 (LV150) spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin lambda variable 1-50 IGLV1-50

UniProt

A0A075B6I6

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYVVHWYQQLPGTAPKLLIYGNSNRPSGVPDQFSGSKSGTSASLAITGLQSEDEADYYCKAWDNSLNA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mmu-miR-7034-5p antagomir
HY-RI03808A-01 5 nmol

Mmu-miR-7034-5p antagomir

Sign In for Pricing
View Details
Mmu-miR-7034-5p antagomir
HY-RI03808A-02 20 nmol

Mmu-miR-7034-5p antagomir

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Brain Protein 44 Like Protein (BRP44L)
MBS2085115-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Brain Protein 44 Like Protein (BRP44L)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Brain Protein 44 Like Protein (BRP44L)
MBS2085115-02 0.2 mL

Cy3-Linked Polyclonal Antibody to Brain Protein 44 Like Protein (BRP44L)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Brain Protein 44 Like Protein (BRP44L)
MBS2085115-03 0.5 mL

Cy3-Linked Polyclonal Antibody to Brain Protein 44 Like Protein (BRP44L)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Brain Protein 44 Like Protein (BRP44L)
MBS2085115-04 1 mL

Cy3-Linked Polyclonal Antibody to Brain Protein 44 Like Protein (BRP44L)

Sign In for Pricing
View Details