Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin lambda variable 5-48 (LV548)

This Recombinant Human Probable non-functional immunoglobulin lambda variable 5-48 (LV548) spans the amino acid sequence from region 20-105. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin lambda variable 5-48 IGLV5-48

UniProt

A0A075B6I7

Expression Region

20-105

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QAVLTQPTSLSASPGASARLTCTLRSGISVGSYRIYWYQQKPGSPPRYLLNYYSDSDKHQGSGVPSRFSGSKDASTNAGILFISGL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAT Iα (m) -PR
sc-149291-PR 10 µM - 20 µL

MAT Iα (m) -PR

Sign In for Pricing
View Details
PTGER1 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-6316R-BF555-TR 20 µL

PTGER1 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
AID CRISPR Activation Plasmid (h)
sc-401542-ACT 20 µg

AID CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
HSF1 Recombinant Monoclonal Antibody [5C7]
A73812-050 50 µL

HSF1 Recombinant Monoclonal Antibody [5C7]

Sign In for Pricing
View Details
Phospho-MEK1 (Thr386) Polyclonal Antibody, PE Conjugated
bs-5413R-PE 100 µL

Phospho-MEK1 (Thr386) Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
Recombinant Shewanella pealeana Probable intracellular septation protein A (Spea_1640), partial
MBS7065609 Inquire

Recombinant Shewanella pealeana Probable intracellular septation protein A (Spea_1640), partial

Sign In for Pricing
View Details