Recombinant Human Immunoglobulin lambda variable 7-46 (LV746)
This Recombinant Human Immunoglobulin lambda variable 7-46 (LV746) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Immunoglobulin lambda variable 7-46 IGLV7-46
UniProt
A0A075B6I9
Expression Region
20-117
Origin
Homo sapiens (Human)
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
QAVVTQEPSLTVSPGGTVTLTCGSSTGAVTSGHYPYWFQQKPGQAPRTLIYDTSNKHSWTPARFSGSLLGGKAALTLLGAQPEDEAEYYCLLSYSGAR
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
032110-ML490 100 µL
ART3, CT (ART3, TMART, Ecto-ADP-ribosyltransferase 3, ADP-ribosyltransferase C2 and C3 toxin-like 3, Mono (ADP-ribosyl) transferase 3, NAD (P) (+) -arginine ADP-ribosyltransferase 3) (MaxLight 490) discontinued
Sign In for Pricing
View Details 