Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 7-46 (LV746)

This Recombinant Human Immunoglobulin lambda variable 7-46 (LV746) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 7-46 IGLV7-46

UniProt

A0A075B6I9

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QAVVTQEPSLTVSPGGTVTLTCGSSTGAVTSGHYPYWFQQKPGQAPRTLIYDTSNKHSWTPARFSGSLLGGKAALTLLGAQPEDEAEYYCLLSYSGAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Antidiuretic Hormone (ADH) Antibody Pair
abx370919-01 5x 96 Tests

Antidiuretic Hormone (ADH) Antibody Pair

Sign In for Pricing
View Details
Antidiuretic Hormone (ADH) Antibody Pair
abx370919-02 10x 96 Tests

Antidiuretic Hormone (ADH) Antibody Pair

Sign In for Pricing
View Details
pEnCMV-DUSP10-3×FLAG-SV40-Neo Plasmid
PVT37772 2 µg

pEnCMV-DUSP10-3×FLAG-SV40-Neo Plasmid

Sign In for Pricing
View Details
Human NKG2C/CD159c Alexa Fluor 700 Antibody (Clone 134522)
FAB1381N-100UG 100 µg

Human NKG2C/CD159c Alexa Fluor 700 Antibody (Clone 134522)

Sign In for Pricing
View Details
Krt77 siRNA Oligos set (Rat)
26046176 3x 5 nmol

Krt77 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
Olr1384 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV628271 1.0 µg DNA

Olr1384 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details