Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin lambda variable 2-33 (LV233)

This Recombinant Human Probable non-functional immunoglobulin lambda variable 2-33 (LV233) spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin lambda variable 2-33 IGLV2-33

UniProt

A0A075B6J2

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSALTQPPFVSGAPGQSVTISCTGTSSDVGDYDHVFWYQKRLSTTSRLLIYNVNTRPSGISDLFSGSKSGNMASLTISGLKSEVEANYHCSLYSSSYTF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BRCA1, phospyhorylated (Ser1423) (Breast Cancer 1, Early Onset, Breast-Ovarian Cancer Susceptibility) (MaxLight 750) discontinued
B2709-01D1-ML750 100 µL

BRCA1, phospyhorylated (Ser1423) (Breast Cancer 1, Early Onset, Breast-Ovarian Cancer Susceptibility) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Matrix Metalloproteinase 9 (MMP9)
MBS2121119-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Matrix Metalloproteinase 9 (MMP9)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Matrix Metalloproteinase 9 (MMP9)
MBS2121119-02 0.2 mL

Cy3-Linked Polyclonal Antibody to Matrix Metalloproteinase 9 (MMP9)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Matrix Metalloproteinase 9 (MMP9)
MBS2121119-03 0.5 mL

Cy3-Linked Polyclonal Antibody to Matrix Metalloproteinase 9 (MMP9)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Matrix Metalloproteinase 9 (MMP9)
MBS2121119-04 1 mL

Cy3-Linked Polyclonal Antibody to Matrix Metalloproteinase 9 (MMP9)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Matrix Metalloproteinase 9 (MMP9)
MBS2121119-05 5 mL

Cy3-Linked Polyclonal Antibody to Matrix Metalloproteinase 9 (MMP9)

Sign In for Pricing
View Details