Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin lambda variable 2-33 (LV233)

This Recombinant Human Probable non-functional immunoglobulin lambda variable 2-33 (LV233) spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin lambda variable 2-33 IGLV2-33

UniProt

A0A075B6J2

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSALTQPPFVSGAPGQSVTISCTGTSSDVGDYDHVFWYQKRLSTTSRLLIYNVNTRPSGISDLFSGSKSGNMASLTISGLKSEVEANYHCSLYSSSYTF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MGAT1 Protein Vector (Rat) (pPM-C-HA)
PV282096 500 ng

MGAT1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
MYO3B Antibody, HRP Conjugated
MBS7114371-01 0.05 mg

MYO3B Antibody, HRP Conjugated

Sign In for Pricing
View Details
MYO3B Antibody, HRP Conjugated
MBS7114371-02 0.1 mg

MYO3B Antibody, HRP Conjugated

Sign In for Pricing
View Details
MYO3B Antibody, HRP Conjugated
MBS7114371-03 5x 0.1 mg

MYO3B Antibody, HRP Conjugated

Sign In for Pricing
View Details
Rabbit monoclonal antibody against MLH1(clone EPR3893)
TA307734 100 µL

Rabbit monoclonal antibody against MLH1(clone EPR3893)

Sign In for Pricing
View Details
GTF3C6 Protein Vector (Rat) (pPM-C-HA)
PV271964 500 ng

GTF3C6 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details