Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 3-22 (LV322)

This Recombinant Human Immunoglobulin lambda variable 3-22 (LV322) spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 3-22 IGLV3-22

UniProt

A0A075B6J6

Expression Region

21-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YELTQLPSVSVSPGQTARITCSGDVLGENYADWYQQKPGQAPELVIYEDSERYPGIPERFSGSTSGNTTTLTISRVLTEDEADYYCLSGDEDNPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BCL7C (B Cell CLL/Lymphoma 7 Protein Family Member C) (MaxLight 650)
MBS6221094-01 0.1 mL

BCL7C (B Cell CLL/Lymphoma 7 Protein Family Member C) (MaxLight 650)

Sign In for Pricing
View Details
BCL7C (B Cell CLL/Lymphoma 7 Protein Family Member C) (MaxLight 650)
MBS6221094-02 5x 0.1 mL

BCL7C (B Cell CLL/Lymphoma 7 Protein Family Member C) (MaxLight 650)

Sign In for Pricing
View Details
OVCA2 siRNA (Human)
MBS8240510-01 15 nmol

OVCA2 siRNA (Human)

Sign In for Pricing
View Details
OVCA2 siRNA (Human)
MBS8240510-02 30 nmol

OVCA2 siRNA (Human)

Sign In for Pricing
View Details
OVCA2 siRNA (Human)
MBS8240510-03 5x 30 nmol

OVCA2 siRNA (Human)

Sign In for Pricing
View Details
3-Amino-1- (4-sulfamoylphenyl) urea
MDA01380-01 50 mg

3-Amino-1- (4-sulfamoylphenyl) urea

Sign In for Pricing
View Details